DPCstruct | MC2936
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 67 ± 4 aa |
| Standard deviation of domain lengths | 4.04 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 66.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9HTV3 | 117-192 | YNRAFVLMQYFGYLRRNPSDPPDGNLAGFNFWVTVLNNSSLPGEDVRNPAQALARIRRARIVEAFITSTEYRARFG |
| A0A2V8L9V2 | 12-80 | HGYNSAFVLWVYRGILQREPNAPPDNNWDGFKFWVGVLDGTNPDAGDYKYSQVLKGFIVSTEYRSRFGP |
| A0A7V9R5W5 | 8-73 | None |
| A0A2V8MCE5 | 637-706 | None |
| A0A2V8M430 | 2-61 | None |
| A0A2V8QYX7 | 789-853 | None |
| A0A2V8QUS4 | 285-346 | None |
| A0A2V8L5I4 | 990-1053 | None |
| A0A838S1B6 | 105-171 | None |
| A0A7V9TVT9 | 598-661 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.