DPCstruct | MC29356
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 461 ± 78 aa |
| Standard deviation of domain lengths | 77.95 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 36.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815NSQ8 | 31-613 | AKQCEKGGECSQINDKNHCSKWKHPDYCPDGGHCKNQQFDHLKKYRHLPLCSKSHKCIDYQKEVKEHCEKFRHFAPRCPYGNNCVDF… |
| A0A433QV33 | 164-567 | HIKPCKRKGLCIEHDDPGHAELFSHPSHCENGGGCTSMEDAHLQQFLHVPVCAEGVACSNREVKQHAEKFRHIKSQCPYGSFCGQYM… |
| A0A820U2F9 | 158-772 | None |
| A0A814GEF2 | 13-387 | None |
| A0A819EWH5 | 3-393 | None |
| A0A819BMR4 | 18-628 | None |
| A0A821HF11 | 48-506 | None |
| A0A433Q935 | 1-365 | None |
| A0A815T1B3 | 23-482 | None |
| A0A819ZYQ8 | 410-980 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.