DPCstruct | MC29355
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 48 ± 4 aa |
| Standard deviation of domain lengths | 4.03 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 87.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0714 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444T4T3 | 68-112 | TAVLLLLSLPVLAGAITILLTDRNLNTSFFDPRGGGDPILYQHLF |
| A0A183IAL6 | 2-50 | LIVSLPVLAGGITILLMDRNLGTSFFETSGGGDPVLFQHIFWFFGHPEV |
| A0A444SVD7 | 146-189 | None |
| A0A444SCG8 | 76-120 | None |
| A0A444TSX3 | 72-123 | None |
| A0A0C3AKG5 | 132-187 | None |
| A0A1V2N2A4 | 1-48 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.