DPCstruct | MC29354
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 303 ± 53 aa |
| Standard deviation of domain lengths | 53.34 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 17.74 |
| Pfam Score | 63.40 |
| Assigned Pfam label(s) | CL0208- PF06113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7U399 | 10-327 | VLVPLVEECFRNDKINGQGGMMAITGVKSSLINGPTDKLCDRFTVSVPYCGSHIKWEVIFNHKYPTEPPDIVWSADDDINNFDPEID… |
| A0A433QJT8 | 10-328 | SISHLTHTSARSKKFTVLAVKSSDPYFDDASDGVIHSPIDRLDLLIHYCGRDLSCQIIFDPADLAFPPDVILPAISTDFSVSLRQLY… |
| A0A6B0RGB1 | 50-380 | None |
| A0A653CP54 | 3-255 | None |
| A0A310S6R1 | 5-275 | None |
| A0A3Q0KDU0 | 4-245 | None |
| A0A1X7U203 | 6-270 | None |
| A0A1Q9C6M2 | 193-456 | None |
| A0A482VJQ7 | 18-349 | None |
| A0A438E4A7 | 7-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.