DPCstruct | MC29352
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 71 ± 7 aa |
| Standard deviation of domain lengths | 7.29 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 39.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A1VER8 | 1-65 | MTRDELLAAVPVHEYEGRPFYVNLAEIPQPWRDQFWAALYGSQCPKIDGIERAAYAWDWECWANS |
| A0A257V452 | 2-83 | TWQDPPAGAVFNTETPKTKRSLLALVPIHTPSRQRHYILIDDIPHPWRLAFTTALGERQRPILADRRPAAYAWDWRDWVMDR |
| A0A1I7FW11 | 60-124 | None |
| A0A132HBF2 | 166-233 | None |
| A0A7Y9K5D1 | 6-79 | None |
| A0A7W8T5R6 | 57-130 | None |
| A0A2T0L5G3 | 1-68 | None |
| A0A522MJV5 | 81-145 | None |
| A0A2V4TW75 | 1-68 | None |
| A0A7X9X3I0 | 98-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.