DPCstruct | MC29351
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 144 ± 7 aa |
| Standard deviation of domain lengths | 7.49 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 76.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 55.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09766 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9EIK5 | 283-415 | DVRSFLSTVVLERQQKDEIMNTVIDYEEAEAGSRDPEKDKELFRKACDDIRTMMDEITELKTKRSEDSKGEIIDRRIKASLLFVVLK… |
| A0A3Q2HJQ0 | 1-134 | TSSESSNKRKPKVIRSDGAPQEGKYYSEEAEVGLWDPGRDYELYKYTCRELQKLMAKIQDLKSRGGKHVAVEIEDRRIQGCVHFMSL… |
| V4B7Q0 | 4-148 | None |
| A0A2I2YRY0 | 1-149 | None |
| A0A0S7LDL2 | 1-153 | None |
| A0A7F8Q7G9 | 62-207 | None |
| A0A6J1W2H7 | 1-134 | None |
| A0A1V4JSN8 | 310-458 | None |
| A0A091CQ13 | 1-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.