DPCstruct | MC2935
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 111 ± 6 aa |
| Standard deviation of domain lengths | 6.37 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 42.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03534 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M0GH73 | 252-369 | VFDYGEYDIDAVIAGTNLTPYTPTQDWAYRPDPFSLYRATFEVRTMRRCFHTLCFHRFPEELGTVEPVLVKASKYIYHTGDYSRLSQ… |
| A0A0F7ND45 | 1-110 | MVFGYGEHDEDAPAPGEVLPWPVRADPWSTRRPGFEVRTYRPCRRVLMFHRTPELGPRPQSASALLLGYDEDPAATRLVSLTHRGYV… |
| A0A2U8I376 | 178-283 | None |
| A0A379S3J6 | 1-97 | None |
| B6A880 | 268-378 | None |
| A0A379SII9 | 1-120 | None |
| A0A379SW18 | 115-226 | None |
| A0A5C4QLR1 | 316-424 | None |
| A0A4S3J4S5 | 244-357 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.