DPCstruct | MC29346
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 173 ± 25 aa |
| Standard deviation of domain lengths | 25.35 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16089 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484B601 | 2-195 | EALSVFIVGLLQLLGYSYFMSQPEDQCSPAPCLGSWLFLLATLCFLWDLSIYPRRFMHMAWQCQLLVEIVAGLFLAEIAMLRIWCGL… |
| A0A1A9WTE3 | 1-194 | MVSMYSLSVVAAINMWLSVSFFIEQDEDQCSRAPDLASWIFTIGLMDILWTIRIFSRRYQFLPLICRIICEIIFGLLFMEFSLLIVW… |
| A0A3B0JUI9 | 1-152 | None |
| A0A1B0BCP5 | 61-249 | None |
| A0A1A9XPZ0 | 50-187 | None |
| A0A6P5VNR8 | 5-170 | None |
| B4KJC4 | 20-178 | None |
| A0A1W4VW45 | 1-131 | None |
| B4N1E3 | 1-202 | None |
| A0A7M7GEU8 | 16-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.