DPCstruct | MC29345
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 623 ± 120 aa |
| Standard deviation of domain lengths | 120.26 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 71.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0064 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A9WP15 | 3-537 | ISKAVVFFVVLIISLCVARPLNYARAGLLGIFCTQSNDFAIGYPIVMALYKTIHPEYASYLYLMAPISLAILNPIGLILMEIDKIIK… |
| A0A2J7QU36 | 103-577 | LVAKTVVFLVVVVVTLLVSRPVNTGRAGLFAIFCTQSNDFAIGYPIVGALYQKTHPDYASYLYLMAPISLVILNPLGFILMELSKHD… |
| A0A6P6Y5K4 | 8-806 | None |
| A0A0S7JMC8 | 2-646 | None |
| A0A2C9JKS5 | 1-666 | None |
| T1HD39 | 102-681 | None |
| H9JQC7 | 2-583 | None |
| A0A7S1U311 | 2-666 | None |
| A0A182P130 | 185-992 | None |
| A0A814CDJ7 | 2-474 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.