DPCstruct | MC29344
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 94 ± 12 aa |
| Standard deviation of domain lengths | 12.33 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 53.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A9WFT1 | 9-106 | IKVYDDVPNSAVELQVKDKFLRKLNRQERVVEEVKLVLKPRFNKKQITKEDYKEIMRRAVPKICHSKSGEIDPHKIKNLIDAYVKKF… |
| T1ERR0 | 156-231 | EVYMEMKRLQEVEEMVKNILRPHYIDKHITKEDYKLVMKKAVPKIMNSRCRRLDEVKVFNFVSAYIVTVLGKRHLV |
| D4ABH1 | 1332-1427 | None |
| S9XP62 | 173-270 | None |
| A0A668ANI8 | 857-953 | None |
| I3ITF2 | 1422-1516 | None |
| A0A673AU85 | 107-191 | None |
| A0A665UNS5 | 754-849 | None |
| A0A1J1IHJ1 | 819-920 | None |
| A0A132AH17 | 1-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.