DPCstruct | MC2934
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 85 ± 6 aa |
| Standard deviation of domain lengths | 5.89 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 93.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 49.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C1TEX1 | 186-268 | FRLSNLAGYVKYNMPFGATYERPQLSDEESWDVAAFVNSMPRPSKDLSKDWPNIAGKPFDHPFGPYADPFSERQHKYGPFKPI |
| A0A4Y8CEF1 | 1-81 | MYRLIKAASYIKENMPQGAPDLSLEDAYDVAAYMNSQARPIKANRDKDFPDRKVKPLDMDVGPYDDSFSTTQHRYGPYTNM |
| A0A257UKP2 | 1-77 | None |
| A0A537T3N5 | 1-100 | None |
| A0A7K3MV16 | 85-173 | None |
| A0A258LXV8 | 105-194 | None |
| A0A851H588 | 53-132 | None |
| A0A826DX75 | 43-125 | None |
| A0A1W9ML97 | 546-629 | None |
| A0M0W4 | 1-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.