DPCstruct | MC2933
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 96 ± 9 aa |
| Standard deviation of domain lengths | 8.85 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.69 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A897NF60 | 1-97 | MTDNHGYNTPPQGELDWHVPLNENFNAIDTDIEIRDENENRSNYEPKQGAKYLATDTGDVYLGDGTDWQSLGSITNVTVGSTAPSDP… |
| A0A8A2VHX3 | 1-117 | MTDNHDYDAPEKGATDWHLPLNSNFEQLDTDVEIRDSEGELNSYQPKAGAKFFATDTGNVYLGDGSKWTRAPTGTRLDGDVVNRTEP… |
| M0D748 | 47-132 | None |
| A0A2R6EYJ4 | 3-103 | None |
| A0A1I6J5S8 | 1-94 | None |
| A0A2R6HJS7 | 3-108 | None |
| A0A7T3G0X3 | 2-85 | None |
| A0A2Z2HUX8 | 1-84 | None |
| A0A1I2U6P5 | 1-90 | None |
| A0A6G8TBK9 | 8-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.