DPCstruct | MC29323
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 172 ± 20 aa |
| Standard deviation of domain lengths | 20.27 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20046 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L8V5L5 | 2-143 | LKWITDEQEQKIVPLFNKTYNLKNGDKEVYTLVEKHFLETLVRLHRETEGASYSGLKPAGTTKQIIQMTDKALDEGNVDDFLTKLNS… |
| A0A1N6EMB0 | 20-196 | FLSPVTASAHCDTMDGPVIGDAQTAIKENNINYIAKWVSPEEEANLTDIFNQTMEVRDDSPEAQELADQYLFENLVRVHRAGEGAPY… |
| A0A285X3K0 | 25-197 | None |
| A0A1V5TSL7 | 22-205 | None |
| A0A062UYZ5 | 30-208 | None |
| A0A2T1K3S3 | 2-163 | None |
| A0A154QL82 | 19-207 | None |
| A0A3D1TF89 | 4-183 | None |
| A0A512TSH4 | 8-208 | None |
| A0A021VRB9 | 2-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.