DPCstruct | MC2932
Metacluster Properties and Pfam Annotations
| Number of structural domains | 235 |
|---|---|
| Mean domain length (aa) | 109 ± 17 aa |
| Standard deviation of domain lengths | 17.46 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.05 |
| Pfam Score | 98.73 |
| Assigned Pfam label(s) | CL0023- CL0465- CL0632 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M2PDU0 | 3-93 | QAQFDKAVAIVKSLPKDGPIKPTQDEQLYFYKYYKQGTEGDVNTARPGMLDFVGKAKWDAWDSVKGVSKEDAWAKYVEKLLEILNRV… |
| A0A6A5C288 | 3-108 | SSPSSSQLETEFKQAQQFVQSGPAESEPSNEQKLLFYAYFKQATEGPNTGKRPGAFDLIKRAKYDAWKKLGDMSKEDAMKGYIANLE… |
| A0A7S0A097 | 27-124 | None |
| A0A6J1WFZ1 | 34-137 | None |
| A0A6A3B4E4 | 4-140 | None |
| A0A7J6Q8B3 | 5-96 | None |
| L9JGE6 | 3-83 | None |
| A0A7J7FM51 | 90-191 | None |
| T5AGW7 | 2-122 | None |
| G9NJA8 | 2-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.