DPCstruct | MC29318
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 147 ± 15 aa |
| Standard deviation of domain lengths | 14.50 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 64.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 37.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4E6R7 | 1-171 | MINMDLQQHSSMFKIRALVQQLRPNFIEVLQTPDFRNSEAADEIRQQMKLLMDLYEQMAKDAGDTHRKFVSETQHSTHDSDPVKENQ… |
| A0A6P6B086 | 52-183 | NRNDHFQNSKYFKMRLVLKDLRPHFIEVLRTPDFRNCTAANEIKEKMKLLVELYKQMTAETVSESLPGETGMKQKPEGQPQEKQQSE… |
| A0A7J8M5U7 | 1-151 | None |
| A0A445DDA8 | 115-266 | None |
| A0A1D1YXZ7 | 108-268 | None |
| A0A2I0I7K4 | 45-205 | None |
| A0A833VXU9 | 94-240 | None |
| A0A2R6Q8W5 | 103-230 | None |
| A0A7N2MI19 | 68-211 | None |
| A0A067H2B8 | 46-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.