DPCstruct | MC29317
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 58 ± 3 aa |
| Standard deviation of domain lengths | 3.46 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 41.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y1RYU8 | 1-68 | MGLVFFALAASDCVRRYEPFKNISSDSEPFVIPDLPGEIKMTRAQVPGFIKDNIENDLTRLLKTVQGS |
| A0A7J7HSI8 | 57-111 | FYHCVFHNLKLYAPHEKVRSETETFVVPGLPDEIEMTRSQLQDHLKTKTSYGQVL |
| A0A2P6PM09 | 3-58 | None |
| A0A6P5TLU9 | 56-114 | None |
| A0A2G3B412 | 4-61 | None |
| A0A2I0HP72 | 76-132 | None |
| A0A6P6VJX6 | 75-130 | None |
| A0A2G2VHJ7 | 4-61 | None |
| A0A314XWU4 | 3-60 | None |
| A0A834G7Z8 | 40-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.