DPCstruct | MC29313
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 106 ± 9 aa |
| Standard deviation of domain lengths | 8.94 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 67.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 39.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0081 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7FT53 | 319-416 | YYFDPVSGRRFRSKKEVDYFLETGSTRKRKRDPDTNSLENSGGRKSSAPLNFEFNDVPENVRWVLTNASRDQWTPFVGDKMVPKSTR… |
| A0A4Y1RKM5 | 2-113 | LYYVDPVSGRRFRSKVEVLYFLETGTIKRKKTTENASGDKTSVEGSGSHKQKKSSTKPKSSALNFDFVNVPENVVWVLTDSSAGSWT… |
| A0A484NCM3 | 118-221 | None |
| A0A1U8AAF7 | 184-294 | None |
| A0A7J8YKS2 | 7-119 | None |
| A0A5C7IXT4 | 158-265 | None |
| A0A443P3A4 | 71-161 | None |
| A0A7N2KPK7 | 223-333 | None |
| A0A2G2V5P1 | 92-211 | None |
| D7SKF1 | 33-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.