DPCstruct | MC29312
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 120 ± 16 aa |
| Standard deviation of domain lengths | 15.78 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 39.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0713 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y1RKC5 | 2-100 | LTSVWIIAHECGHHAFSDYQIVDDVVGLVLHTALLVLYFSWKYSHRRHHSIDIGSMEREEVFVPKPKSKMPWYTNYFNNPPGRLLVI… |
| A0A067ENB7 | 168-285 | FWALFVLGHDCGHGSFSNDHKLNSVVGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHPLSEKIYRTLDSATRFLRFKIPFPL… |
| F8QGN9 | 99-236 | None |
| A0A507EEX6 | 569-709 | None |
| A0A0D9XVW1 | 86-175 | None |
| A0A6A6L830 | 830-947 | None |
| W4GVJ2 | 91-185 | None |
| A0A830CDG0 | 159-258 | None |
| A0A4Y9Z8P3 | 641-777 | None |
| A0A445BED3 | 309-451 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.