DPCstruct | MC29311
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 75 ± 7 aa |
| Standard deviation of domain lengths | 7.16 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 40.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D6PBM3 | 94-176 | IADAVEKVGHDGIITVEEAKSMETSLKVVEGMEFDKGYVSPYMITDREKREAVLENPKILFTDHTVSAAQDLIPALEVAVKQA |
| A0A5H2XM98 | 14-86 | GGDTLFRYRDGKTLDNELEVVKGKKLDRGYISPYFITNQNNQKCELENPLIIIHEKKISSINAVVKVLELVLQ |
| A0A835HBS4 | 135-215 | None |
| A0A6J5UPQ3 | 1-60 | None |
| A0A158DQP6 | 1-75 | None |
| A0A0A9CLX3 | 1-86 | None |
| A0A0A9NYR2 | 1-72 | None |
| S3H726 | 60-132 | None |
| A0A0K2R258 | 1-80 | None |
| A0A813KUB9 | 572-641 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.