DPCstruct | MC2931
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 173 ± 31 aa |
| Standard deviation of domain lengths | 31.30 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822EXM8 | 2-175 | GYNFTAGVEDCRNALIHFGLQELKPSTIARMLSVMIKTYSGLNEHTHIYDSNGSDITINNEKNPFQTWNVDTFVLAINDLVPTVNWK… |
| A0A091E101 | 253-417 | SSLADFMQEVGYGFCASIEECRNIIMQFGVREVTAAQVARVLGMMARTHSGLTDGIPLQSISAPGSGIWSDGKDKSDGTQAHTWNVE… |
| A0A0S7JDY7 | 12-182 | None |
| A0A816NGH5 | 160-331 | None |
| A0A2G3BT35 | 5-161 | None |
| A0A2G8LNY9 | 241-412 | None |
| A0A446IZM3 | 231-378 | None |
| A0A5S6Q9N1 | 1-149 | None |
| M0ZGY9 | 5-214 | None |
| A0A6V7TWI7 | 1-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.