DPCstruct | MC29308
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 84 ± 5 aa |
| Standard deviation of domain lengths | 5.24 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 20.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J4PPB0 | 1-87 | MLRTLNSEFDLARLMPCDEELVIAFVPTNRDIYRILQTCHKLKSVYIHPDTFKEMPCVGQTLLYMQKVELVVDDDVPESPSQQGGYA |
| A0A524Q9A9 | 1-83 | MKMVIGNPDTLIHVNSHVKQVHITFRPSEKAIFRLINKCPGLESVQIPASHMKSISNTTKSILELRGITLSEGSTRDTERYIQ |
| A0A0E3LDB6 | 12-91 | None |
| A0A662P9S4 | 1-93 | None |
| A0A7J4JG97 | 1-83 | None |
| A0A842QAH8 | 1-91 | None |
| A0A1L9C3V5 | 2-79 | None |
| A0A0G1RZ04 | 126-206 | None |
| A0A7C3YB76 | 1-82 | None |
| A0A2M7XGR8 | 2-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.