DPCstruct | MC29305
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 89 ± 4 aa |
| Standard deviation of domain lengths | 4.44 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 23.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5S9MAU5 | 57-145 | VDVEYYTDANLAVQLKVLEIDQTTEKEAVSVHYGDVTVNAMPTIFKKIRLSTGENIGSGPIHLPEEEIHTSAAWFELHEAERRFEEK… |
| A0A419JIB8 | 1-99 | MLDEETKAEYYTKALFTSDISIKEKYTEKTLPSCRDAKVGLGDVEVVEQVTGYKRYKYFSDVVLGECPLEMPELSLETVALWIELPD… |
| A0A7C3LBX6 | 24-112 | None |
| A0A1Y2HCI9 | 705-789 | None |
| I1CDR5 | 632-723 | None |
| A0A0K2RNM5 | 106-183 | None |
| A0A5A8EQ68 | 397-485 | None |
| T0LS23 | 146-233 | None |
| A0A3R6VTI3 | 328-419 | None |
| A0A0G4NEY1 | 1-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.