DPCstruct | MC29302
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 125 ± 11 aa |
| Standard deviation of domain lengths | 10.50 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 27.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03699 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A800AGB8 | 564-681 | KDLFKIQAYMYGLYHMQDVQVFYNQEDLWTIPYEMYSDKKQLMSPYYVTLKMPDAEKEEFVLILPFTPSDKDNMIGWMAARSDFPHY… |
| A0A368PF36 | 5-123 | PDLFKIQSAIYNTYHTDNVKVFYNKDGAWQIPGEVCGTGHRVQVEPYYIIIKLPGEEKAEFVPMSSFTPIRKDNMVAWLADRSDGDN… |
| A0A6L7WS05 | 105-218 | None |
| A0A3B8ZVC1 | 10-106 | None |
| A0A1X7MMI0 | 31-167 | None |
| A0A1C0UVL0 | 799-916 | None |
| A0A497P060 | 317-451 | None |
| A0A6G3VHD4 | 266-371 | None |
| A0A336P3K8 | 305-423 | None |
| A0A7V5SRR2 | 26-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.