DPCstruct | MC29301
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 60 ± 7 aa |
| Standard deviation of domain lengths | 7.03 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 58.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0179 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D2XTC4 | 2-55 | AKWVYMFTEGNADMRNLLGGKGANLAEMTNLGLPVPQGFTITTEACTQYYEDGR |
| A0A2V3JW18 | 9-72 | NNVNAKRSVYFFGDGRSGGNARMKDLLGSKGANLAEITNIGIPVPLGFTISIEACMHYYVHDGG |
| A0A1Z1WQJ5 | 1-46 | None |
| A0A2R7RX13 | 4-62 | None |
| A0A2U1QDL6 | 124-184 | None |
| A0A542U5T0 | 3-48 | None |
| A0A388PGN6 | 2-71 | None |
| A0A1D6FQF4 | 2-63 | None |
| A0A5Q5G2R0 | 2-53 | None |
| A0A812S062 | 2-58 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.