DPCstruct | MC2930
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 220 ± 16 aa |
| Standard deviation of domain lengths | 16.46 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 75.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 54.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00066- PF11380 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9LU58 | 1-192 | WIRNVFIVTNGQIPNWINLENHRVRIITHEEIFTNKSHLPSFSSPAIESHIHRIPGLSKKFLYLNDDILLSQPVYPEDFYTKSKGYK… |
| T0QWW4 | 117-341 | NRFRDNDELRYSIRSLETYAPWIRRIFLVTDGQVPTWLDLSHPRITVVPHSDIFPNASHLPSFASPAIESHLDNIPGLAEYFLYFND… |
| A0A067CYD4 | 70-305 | None |
| A0A2Y9QZ77 | 23-255 | None |
| D8LXX1 | 132-366 | None |
| A0A6J0WK18 | 78-310 | None |
| A0A7R9C2Z4 | 68-266 | None |
| A0A3B4YHW1 | 173-382 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.