DPCstruct | MC293
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 128 ± 17 aa |
| Standard deviation of domain lengths | 16.54 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N1GRG0 | 88-203 | EAPGTAASVLRSAALYLERHGWIQGAYYDSTAASFTPAACMVGAIGMACYGFPVEAPAQHFDDPGFLDFEEAVLHLDRYLLVEDGSQ… |
| A0A6N3KBM0 | 5-110 | DTPAADILTAAADVIAQRGKCTGDYTDEQGRVCALGALRLVLTGEAMPMPFDDRDRQVAYIDAFTTLGRHLEAVDANAPAIYEWSDA… |
| A0A2S9PY63 | 3-105 | None |
| A0A2S9PY73 | 5-108 | None |
| A0A7J9Z5X6 | 3-135 | None |
| A0A559UHA9 | 6-124 | None |
| A0A2T7JW53 | 52-164 | None |
| A0A6I5D3V3 | 4-140 | None |
| A0A327ZKQ5 | 4-142 | None |
| A0A1Y2NSW7 | 44-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.