DPCstruct | MC29293
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 102 ± 16 aa |
| Standard deviation of domain lengths | 15.88 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 44.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F7D8G8 | 233-355 | SAPTPTPGPFPHGDPALNEQEKELQRRLRRLYPAVDERDTPLPRSWSPKDKFSYIGLSQNNLRVHYKGHGKTPKDAASVRATHPIPA… |
| K1RJX7 | 1-101 | MAATSGFSSTESLNSSIQEIPDPLKQLYPAVNEEETPLPRAWSSKDKYNFIGLTQNNLRVHYKGVGKNHKDAASVRASHPIPPSCGI… |
| A0A397TWL7 | 2-75 | None |
| A0A8B6CKG1 | 1-101 | None |
| A0A5C6NZV1 | 4-110 | None |
| A0A7R9ASK1 | 1-99 | None |
| A0A842Z138 | 69-183 | None |
| A0A6V7TSL0 | 53-188 | None |
| A0A6L5CKK6 | 2-95 | None |
| A0A397VE99 | 8-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.