DPCstruct | MC2929
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 384 ± 79 aa |
| Standard deviation of domain lengths | 79.24 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 76.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D2VQ25 | 156-450 | YNISTAYDQDKLNEWEKRGIEKVKKNLVKYYEFLKEKKKKFETCGLIGDLEVDAQNMVCKDRFMFNTFCAPILSNSSRRVLTSEPYM… |
| D2VI11 | 47-471 | KLMRELDRTLTTKSNVNNTTSPSSLTTINSPSTPHTPQIDEDVAIKKCLSKLDKLKGLQNLSDKQKKDKAKNLVVKKHLLNSYLNKD… |
| D2VK52 | 203-703 | None |
| D2W173 | 231-629 | None |
| D2VY57 | 8-292 | None |
| A0A6A5BQY8 | 277-656 | None |
| D2V1U2 | 460-800 | None |
| A0A2P4P1X3 | 2-334 | None |
| A0A6A5BZ45 | 146-682 | None |
| D2V9D9 | 121-464 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.