DPCstruct | MC2928
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 102 ± 13 aa |
| Standard deviation of domain lengths | 12.87 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0672 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5BYG7 | 134-247 | FSNLGTEGPNGPTSVDTYYSDQPDLNGKVTLVNGIQQWTVPFDGRFLITAAGAAGGSNPYNNSIRAGYGAEVSGVFQLNKGTVECSF… |
| A0A1S3HP96 | 123-214 | NMTFTNLGATGRLGPTSVGKYYDGQDHQGKVTLVNGTQFFTIPVSGLYRIRAAGAAGGCDNGRCHDRSHGAVVAGTFNLKAGRQLKI… |
| A0A2B4R6N3 | 9-105 | None |
| A0A2B4R4V3 | 504-598 | None |
| A0A2B4R0C7 | 89-188 | None |
| A0A132A5N4 | 1-118 | None |
| A0A6G0TQ69 | 87-227 | None |
| A0A811V7S8 | 405-513 | None |
| T1PHZ5 | 160-276 | None |
| A0A518VAL6 | 9-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.