DPCstruct | MC29278
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 68 ± 6 aa |
| Standard deviation of domain lengths | 5.91 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 62.58 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | PF04874- PF01778 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G8LEC0 | 1-64 | MKTIERAAFPNKLWERVKLSKNFEKALKQIDDNLIFWPSFYKYKCKQRLTKITQYLIRMRKIMM |
| A0A059D0T9 | 1-64 | MKSIERAHMPEKLWERVKLPRNYEKALEIIDKHLMYWPKFLVHKTKQRLTKMTQMRIRMRKLAL |
| A0A4S8IY64 | 64-127 | None |
| A0A5A7R1J4 | 834-907 | None |
| A0A093XJN0 | 67-145 | None |
| A0A505HUT5 | 67-131 | None |
| A0A2H3HHF9 | 66-129 | None |
| A0A098VWC2 | 1-73 | None |
| A0A834VRL9 | 68-128 | None |
| A0A453DX98 | 1-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.