DPCstruct | MC29274
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 173 ± 16 aa |
| Standard deviation of domain lengths | 15.73 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 21.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09773 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183HID5 | 5-165 | ELRKKVSEDGFSCIECPMSENETQCSSCPFRHFVQRTISADGILKAENCKKCPANNKVSIHGDTCILCLKTDDSCECQDDETCQKAE… |
| D8LKP2 | 2-195 | VLLETYQGGDYMTEKACQSCAAGTFVFEEASTEAGVSYAADPLSCQACPDDNMSFGLDGQCSCNDGYTIVGASALGPLRCVVTSHVT… |
| A0A388KUU7 | 1-187 | None |
| A0A2P6MXG7 | 100-251 | None |
| A0A6P3S4T5 | 117-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.