DPCstruct | MC29272
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 173 ± 24 aa |
| Standard deviation of domain lengths | 23.62 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2CTM9 | 29-190 | LILVASNDTPRRLIMAPTQNTDASAIEILSETHSAIHTLFSAFEPVNPDRLVYALCGLLFSHTNPAPFGGSKRHPGFTEFEGGSVEE… |
| A0A1Y2BFN6 | 1-147 | MSNPPPKKPRDLLHITSSPTDPLRVTLATSPQDSTLQSTTETTITLLTTLFSSTRVHKDRFIYALAGCLFTPTSPTPFGGSKTKPGY… |
| A0A507EBQ1 | 7-169 | None |
| A0A507F6K6 | 47-252 | None |
| A0A507E4M6 | 93-304 | None |
| A0A507FNG9 | 133-315 | None |
| A0A507FN95 | 3-170 | None |
| A0A1Y2C4F3 | 52-199 | None |
| A0A1Y2CXC6 | 4-192 | None |
| A0A1Y2D1S0 | 39-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.