DPCstruct | MC2927
Metacluster Properties and Pfam Annotations
| Number of structural domains | 109 |
|---|---|
| Mean domain length (aa) | 86 ± 12 aa |
| Standard deviation of domain lengths | 11.98 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09360 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A522GM20 | 3-79 | KSVVAMNSPIDVELVEGQEYHWCRCGRSKNQPFCDGSHEGTGITPLAFKARDTGEASLCRCKQTRNAPYCDGHHSSI |
| A0A6A5BUS7 | 29-116 | VNDISSLKLPVVAQAGPYKVTLEEGKRYSWCTCGLSEKQPFCDGKHKGSGMKSLKFEATPEMCKEVYLCGCKQTANPPFCDGSHSKCE |
| A0A1Y2HKK3 | 66-144 | None |
| A0A3Q2UL56 | 19-96 | None |
| A0A482WF67 | 369-461 | None |
| A0A2E1CU27 | 408-484 | None |
| L5JQ93 | 2-90 | None |
| A0A7S0LWW5 | 4-88 | None |
| A0A3B4FV83 | 25-106 | None |
| A0A151HDG1 | 11-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.