DPCstruct | MC29267
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 226 ± 53 aa |
| Standard deviation of domain lengths | 53.35 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 84.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.84 |
| Pfam Score | 93.55 |
| Assigned Pfam label(s) | PF10067- PF20337 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z0SHU0 | 22-233 | FTCLLMAQTCFVIYLTLGYGLTGATSGMSDWNRLNSTAYVANDETGNFMYAAHVLLAIVMIIGGSLQLIPAMRKKHPRFHRYNGRIF… |
| A0A1Y2CKS3 | 37-260 | TQSHESSHDIPLVPILIKRSWTPFSVAMTILSTFFNVYILAMYLVRNPKDWFGIGAIFKKTVMGTVSMYVHFVGGFAVNFIGIMQLV… |
| C1E414 | 148-434 | None |
| A0A1I3DAC0 | 23-252 | None |
| A0A7T8ZBL7 | 2-144 | None |
| A0A7H5ETG2 | 4-142 | None |
| A0A1Y2HLZ0 | 46-269 | None |
| A0A1Q9CHB7 | 652-847 | None |
| A0A2R7SEF2 | 1-135 | None |
| L2GDZ0 | 6-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.