DPCstruct | MC29266
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 234 ± 23 aa |
| Standard deviation of domain lengths | 22.64 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.25 |
| Pfam Score | 54.17 |
| Assigned Pfam label(s) | CL0001- CL0177 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812NJC3 | 161-374 | VTLNRELRSLLYAWVPETTFFLDNPSLVIFPEHSPSEYQNNIYKTQNSETLLTKWAAAGFQEVAERPFKIAQNVQFTFEQIMGILWR… |
| A0A1Y2CHS2 | 1-218 | MQQNLSNALNQKKNIMFYNWMPSFFVSTKPVTKVLFPANVPFEYYKFSVNRMFPLTSDFPTQLLSKLATPKFLADFPELQSLASQFA… |
| A0A812IRJ8 | 62-312 | None |
| A0A418B673 | 14-228 | None |
| A0A812WLS9 | 129-356 | None |
| A0A813BAA4 | 500-780 | None |
| A0A7S1PJQ5 | 129-377 | None |
| A0A813CNE3 | 357-572 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.