DPCstruct | MC29264
Metacluster Properties and Pfam Annotations
| Number of structural domains | 153 |
|---|---|
| Mean domain length (aa) | 158 ± 30 aa |
| Standard deviation of domain lengths | 29.72 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 12.70 |
| Pfam Score | 44.44 |
| Assigned Pfam label(s) | PF07833- PF14064- PF16439 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G0KF92 | 7-155 | GLLAVIGCFLTWGERKGPLSPGMGPPEGWRRVTLPASYSIDLETGAVKGSSKSARDLWWEAKTQTEFCLCPCRLNNGEALMAPVPEL… |
| A0A250IHA5 | 52-258 | EQSIDKLRLRTVVSTGEIREEGTVEGEFHTYVDGRAGGTDSPQSYTYARFTKQGLERVPVDDQSALASGDWDIAFRRYVIRTNGGVS… |
| A0A0C2VE66 | 5-164 | None |
| W5WM48 | 11-135 | None |
| A0A353BIR6 | 20-178 | None |
| A0A7W7H0A7 | 267-432 | None |
| A0A1G0QXS1 | 147-283 | None |
| A0A849WPQ1 | 221-399 | None |
| A0A7W1H077 | 32-189 | None |
| A0A1Y6CFU1 | 28-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.