DPCstruct | MC29263
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 96 ± 18 aa |
| Standard deviation of domain lengths | 17.95 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 44.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I7AHA9 | 5-98 | STKAETARQRLTDVRRLPLRQMAAGDAVELQLGDGRYFLREAAYVIRLDGTTCLQLTDARGIRRIKEGDPLQVATWYQTCFDAGLPV… |
| A0A2J4XUH4 | 1-69 | MELQLDDGHYTIREAAYVIRLDGTTCLQLTDAGGIRRIKEGDPLQVASWYQACFDAGLPVTVQVNESRD |
| A0A3P4P3S5 | 18-132 | None |
| A0A7I0KN75 | 62-166 | None |
| A0A8B3ZKG9 | 12-122 | None |
| A0A5N3CTR0 | 9-109 | None |
| A0A1X7M057 | 85-174 | None |
| A0A7I6TEI5 | 100-206 | None |
| A0A763STU4 | 3-112 | None |
| A0A811DIR3 | 1-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.