DPCstruct | MC29262
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 122 ± 22 aa |
| Standard deviation of domain lengths | 21.75 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 26.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06092 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H8KYD6 | 17-136 | IDTHQAGSFGDIIVNHLPWTDDGKISWWMHHRDEISEKYKIPHRDENGIYHVMIWSFGDGYKEEDDKDRLCFEDMTATQRCIEKNAL… |
| B5F5P8 | 4-122 | HYYSGKDINILARHFPITDRGKLNWWRENERKILEKYNLPGNDFSVYIWDFGDGYQKLSPYDAEDEFYCFPDIKSESKCIKKDIYMS… |
| A0A6M8UHR8 | 15-164 | None |
| A0A2X5AND4 | 239-365 | None |
| A0A378XKL2 | 6-177 | None |
| A0A3R9GNB5 | 36-192 | None |
| A0A735ZSI7 | 29-158 | None |
| A0A6L6HAG9 | 2-93 | None |
| A0A836N8N9 | 2-102 | None |
| A0A389M0B9 | 2-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.