DPCstruct | MC2926
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 91 ± 19 aa |
| Standard deviation of domain lengths | 18.86 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 86.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 50.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15393 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U7R2F9 | 17-94 | IFPSQAEQLARELAWCVEQLELGLKTQRPTPKQKEQAVGAIRTLRSEKTPLPRKRQLMRSLFGDYRAQMDAEWQEALR |
| U3JQK9 | 302-385 | DEQLRKEVDWCVNQLELGLKTQKPTPKQAEEALRAIRTLRSDKAPLVKKRQLMRAMFGDYRKKMQEELCRELKLMETAAKSAKI |
| A0A6P9B1D6 | 9-78 | None |
| A0A3Q3VMG1 | 35-190 | None |
| T1GFC1 | 9-106 | None |
| H2ZSF1 | 160-241 | None |
| A0A7M5UWR1 | 52-129 | None |
| A0A6P4ZUN2 | 39-119 | None |
| A0A3Q0DRT5 | 206-307 | None |
| K7FED8 | 3-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.