DPCstruct | MC29256
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 63 ± 5 aa |
| Standard deviation of domain lengths | 4.80 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 35.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A075V4F2 | 77-134 | ATAWAGATAYAAEFTVRPAPGNGFLYRAVSGGTSGASAPTWPTVVGGTVTDGSVVWEC |
| A0A2H0YY44 | 20-82 | EASQSVRQNSTTYVVGQMVIPTTSNGYVYRCTVAGTSGIAAPTWPTSNGHTVTDGTITWTTYA |
| A0A1E4K7R5 | 899-956 | None |
| A0A2E2DFB0 | 338-394 | None |
| A0A506K1B3 | 795-848 | None |
| A0A1V6E641 | 54-121 | None |
| A0A1V4WVA7 | 583-639 | None |
| A0A7C3X0M3 | 21-83 | None |
| A0A1F2UPJ2 | 392-452 | None |
| F2NCR3 | 428-483 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.