DPCstruct | MC29255
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 55 ± 3 aa |
| Standard deviation of domain lengths | 3.10 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 52.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q50290 | 89-138 | ELPLAGNGSFDSAEAIVLLKQSDIVVTNPPFSLFQDFVCLLAEHGKQFLV |
| A0A5P9XN41 | 71-125 | ITPLNGDGDFRSQECVEILNGSDIVVTNPPFSLFSEYVAQLANHNKKFIIIGHQN |
| A0A847W646 | 1-59 | None |
| K2KHD9 | 79-136 | None |
| A0A6N6LJ13 | 35-89 | None |
| C8PMF5 | 1-52 | None |
| A0A5P9XRE4 | 1-52 | None |
| A0A422M0U1 | 11-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.