DPCstruct | MC29251
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 193 ± 27 aa |
| Standard deviation of domain lengths | 27.36 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 19.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF11153- CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D0IJX1 | 30-218 | QGVITVTPESAPSHLDVQNIIPVVTDYPAIAPLLHNNEVKVETWQNNQFYPRNELERFQKQVASATVLYREITNDWSKVVMLVMQDA… |
| A0A1S2CEQ2 | 74-233 | GYHPRDSYEYTGILMERKRIASEGWLGPHNLDGTLNIEEAYRRQLKEGEVELQFRLWLDRRVKSEYSRIALRQMYRLAADVGVPFKK… |
| A0A5S3XQB0 | 307-561 | None |
| A0A826R7A7 | 49-251 | None |
| A0A1K2IUC5 | 1-201 | None |
| A0A4Q1ANB5 | 653-868 | None |
| A0A2P6JJR5 | 11-215 | None |
| A0A7W4EG92 | 232-438 | None |
| A0A2G6F3M5 | 281-488 | None |
| W6VJU0 | 952-1136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.