DPCstruct | MC2925
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 343 ± 36 aa |
| Standard deviation of domain lengths | 35.54 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.66 |
| Pfam Score | 27.78 |
| Assigned Pfam label(s) | CL0063- PF02585- PF19343 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S7WJD7 | 73-445 | TNFETQAVAAGDLGGIEISANRLVITIGLDTIVHNPDAVAIIIAAGEAKAGIVKQSLELSMTNVYPATVLQKLKNGRFFITKGAASK… |
| A0A6A5BFP6 | 53-410 | LDQKTRLDAAQSFKGISNVPTKAITQGINTILNSKEIILMATGESKAAIVKKAMEFKYEDPSDCPATFLRVHPNCHYYFDIAAGNLL… |
| A0A4Q3WYB7 | 131-427 | None |
| A0A7X0DZ84 | 1-301 | None |
| A0A7Y5SM52 | 34-350 | None |
| A0A5S5CB29 | 1-336 | None |
| S8BNZ2 | 113-451 | None |
| G0QK21 | 2-319 | None |
| A0A7C1T0J9 | 238-621 | None |
| F0R5P7 | 591-921 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.