DPCstruct | MC29243
Metacluster Properties and Pfam Annotations
| Number of structural domains | 95 |
|---|---|
| Mean domain length (aa) | 282 ± 70 aa |
| Standard deviation of domain lengths | 69.98 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 80.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.08 |
| Pfam Score | 85.98 |
| Assigned Pfam label(s) | CL0123- PF11955 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J5B8E3 | 11-215 | DNYKQQAAGRLLKLLMIARVNKIPLHIVDQLRWDLGLPQDYTQTIVPEFPDYFRVTGANDSLLELVCWSNDLAVSVLEKNAMKRVVG… |
| K7MPY9 | 23-286 | EKLMDNYKNLVKVIAIQDLILANPKNRSVSIDFLRKFPHIFHIYYDPSKLKPFCSAINASLPVVADGLVRILSMSSSRIVPLRAVFK… |
| A0A5A7RAG3 | 387-704 | None |
| A0A835LH16 | 18-236 | None |
| A0A835IUX4 | 2-200 | None |
| A0A5D2CW64 | 23-361 | None |
| A0A0E0MC39 | 3-224 | None |
| M4D4P3 | 19-322 | None |
| A0A5N6PC92 | 135-458 | None |
| A0A2U1QNU6 | 143-490 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.