DPCstruct | MC29241
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 114 ± 8 aa |
| Standard deviation of domain lengths | 8.05 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 58.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K7M7I6 | 1-119 | MQSHGKCLADLCGALHCDAVMNFKSSRSKCNPVAAARNRRLCESLADNCFPISEGPSAGCLHELFLHQICDTCSEKHKPFSRGGKDQ… |
| A0A446T2G8 | 135-250 | DNTQGRCLADLCGALHCDLTMEFKKPKSKCNAAAAARNRHLCENLADSCFPINQGHSASRLHEFFLRQFCDAHTCNGGSKPFPKGGR… |
| A0A5E4EQ60 | 69-188 | None |
| A0A6P4CJZ8 | 1-100 | None |
| A0A803LSN5 | 1-103 | None |
| A0A059AH62 | 74-199 | None |
| A0A565C766 | 105-203 | None |
| A0A5J5BGD6 | 33-152 | None |
| A0A498JMK2 | 1-116 | None |
| A0A6N2K3S7 | 471-581 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.