DPCstruct | MC2924
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 112 ± 12 aa |
| Standard deviation of domain lengths | 11.52 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 71.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 38.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5BBX4 | 120-225 | AKEVEIQTETHPIESYIDPKYEFSQWKLRKNVVQAADLRNKKDSKAQTIQSHFRRDNDCQVYLKKEKDTQTPKETGTNPTKHTRYIK… |
| A0A7R9H3L1 | 33-143 | LPEPLMKRDIEMQTELHPIPSYIDPNYTWNEWELKRKAIQLANICRSKTHSTQTNNSHKRASIGVQAQQPKDVGCQTKRDTSTNVPK… |
| A0A5J4WVP7 | 586-687 | None |
| A0A822FQP3 | 90-204 | None |
| A0A2C6L864 | 2-110 | None |
| S9TQB2 | 213-316 | None |
| A4HXB1 | 293-402 | None |
| A0A7S1G774 | 10-118 | None |
| A0A7J6KZS0 | 552-648 | None |
| A0A2P6NJF0 | 18-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.