DPCstruct | MC29239
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 79 ± 5 aa |
| Standard deviation of domain lengths | 4.52 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 75.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D1YCN8 | 806-886 | KVLSLAALNKNESLNGGGTLFVNKHPDLRVRVVHGNTLTAAVILNEIPKGVNEVFLTGATSKLGRAIALYLCRKRIRVLMM |
| A0A4D8YSU8 | 406-486 | KVISLAALNKNESLNGGGTLFTTKHPNLRVRVVHGNTLTAAVILHEIPNDVDEVFLTGATSKLGRAIALYLARRKVKVLML |
| A0A287TRA2 | 410-481 | None |
| A0A453KW70 | 136-221 | None |
| A0A287XUF2 | 304-377 | None |
| A0A1D6HDA3 | 235-315 | None |
| A0A835CEW3 | 312-385 | None |
| A0A287XU64 | 212-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.