DPCstruct | MC29238
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 113 ± 15 aa |
| Standard deviation of domain lengths | 14.93 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 67.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01937 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K7LIY2 | 1-103 | MELDSMDEETTLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSHNKMQRPWRVNDFDAFKQRMLGIGDKKPPPHRRALLFVD… |
| A0A453LF77 | 2-127 | DRLLALIEGVLAANIFDWGSKACVDLYNQGTIIEIYRMSRKKMQRPWRIDDFDTFKSRMLKKDQPYKRALISVDNAGADVVLGMLPL… |
| A0A565CAU2 | 129-233 | None |
| A0A804QE55 | 530-638 | None |
| A0A4U6W9G9 | 530-633 | None |
| A0A1J6J888 | 293-397 | None |
| A0A3P7EZI3 | 4-156 | None |
| A0A183KXT2 | 241-366 | None |
| A0A445ILJ1 | 73-171 | None |
| A0A6J5XB71 | 3-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.