DPCstruct | MC29236
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1652 |
|---|---|
| Mean domain length (aa) | 327 ± 87 aa |
| Standard deviation of domain lengths | 87.43 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 81.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 16.70 |
| Pfam Score | 98.39 |
| Assigned Pfam label(s) | CL0020- CL0013- PF09746- CL0168- CL0093 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378UVL9 | 18-306 | SPAAIKRWVPFVDEITRAALDEHIESGEIDFVEHLANVVPAVFTLAMMGIELKKWNVYSEPTHASVYTPEHSPDREKINEQHREMGI… |
| A0A803NCQ6 | 31-343 | NRPRLIGAKILGYDYTTILWAPYGPLWRNHRRIAATEILSPHRLHLLADIRSEEVRSLVKRINDHAAEGRDKTIEIKPALLELTNNI… |
| A0A0D2PQ57 | 18-275 | None |
| A0A2D0QJ02 | 22-302 | None |
| A0A022RDF2 | 3-180 | None |
| A0A7N2LBD8 | 20-282 | None |
| A0A7N2KTX3 | 86-452 | None |
| A0A068UX80 | 165-601 | None |
| A0A068UNM1 | 3-292 | None |
| A0A2G8L2P9 | 142-428 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.