DPCstruct | MC29232
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 203 ± 34 aa |
| Standard deviation of domain lengths | 34.21 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 68.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 50.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453FQL0 | 1-149 | RSRFPPSRRRTPASRTWRTSERSKGVLELLQKNRDMTFGEVKLTIMIEDPRDVERKRLLGIEDPDELTRDDLADALVEVNEGRIPEN… |
| A0A1R3I567 | 75-242 | EDDEAVASSSQATQQLEDEQVDEEDLQCVRQIQRVLELLRKNRDMIFSEVKLTVMIEDPREVERRRFLGIEDPDAPTRDDLVEALEQ… |
| A0A2R6X6N1 | 55-278 | None |
| A0A1Y5IR10 | 1-226 | None |
| A0A2G5D270 | 59-226 | None |
| A0A834SE22 | 45-249 | None |
| A0A7J7L280 | 1-170 | None |
| A0A1D6N9I1 | 51-277 | None |
| A0A0E0N3N2 | 342-586 | None |
| A0A7G2FI87 | 27-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.